-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AURKA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 301-403 of human AURKA (NP_003591.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against AURKA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 301-403 of human AURKA (NP_003591.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11875A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AURKA |
| Target Synonyms | AIK; ARK1; AURA; BTAK; STK6; STK7; STK15; PPP1R47; AURKA | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 301-403 of human AURKA (NP_003591.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS | Uniprot ID | O14965 |
Uniprot Id
O14965
Target Species
Human
Target Name
AURKA
Target Full Name
Aurora kinase A
Target Function
Mitotic serine/threonine kinase that contributes to the regulation of cell cycle progression. Associates with the centrosome and the spindle microtubules during mitosis and plays a critical role in various mitotic events including the establishment of mitotic spindle, centrosome duplication, centrosome separation as well as maturation, chromosomal alignment, spindle assembly checkpoint, and cytokinesis. Required for normal spindle positioning during mitosis and for the localization of NUMA1 and DCTN1 to the cell cortex during metaphase. Required for initial activation of CDK1 at centrosomes. Phosphorylates numerous target proteins, including ARHGEF2, BORA, BRCA1, CDC25B, DLGP5, HDAC6, KIF2A, LATS2, NDEL1, PARD3, PPP1R2, PLK1, RASSF1, TACC3, p53/TP53 and TPX2. Regulates KIF2A tubulin depolymerase activity. Important for microtubule formation and/or stabilization. Required for normal axon formation. Plays a role in microtubule remodeling during neurite extension. Also acts as a key regulatory component of the p53/TP53 pathway, and particularly the checkpoint-response pathways critical for oncogenic transformation of cells, by phosphorylating and destabilizing p53/TP53. Phosphorylates its own inhibitors, the protein phosphatase type 1 (PP1) isoforms, to inhibit their activity. Necessary for proper cilia disassembly prior to mitosis. Regulates protein levels of the anti-apoptosis protein BIRC5 by suppressing the expression of the SCF(FBXL7) E3 ubiquitin-protein ligase substrate adapter FBXL7 through the phosphorylation of the transcription factor FOXP1.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole. Cytoplasm, cytoskeleton, cilium basal body. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cell projection, neuron projection.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, Aurora subfamily
Target Tissue Specificity
Highly expressed in testis and weakly in skeletal muscle, thymus and spleen. Also highly expressed in colon, ovarian, prostate, neuroblastoma, breast and cervical cancer cell lines.
Target Research Area
Cancer
Target Synonyms
AIK; ARK-1; ARK1; AURA; Aurka; Aurora 2; Aurora A; Aurora kinase A; Aurora-related kinase 1; Aurora/IPL1 like kinase; AURORA/IPL1-like kinase; Aurora/IPL1-related kinase 1; AURORA2; Breast tumor-amplified kinase; BTAK; hARK1; IAK; IPL1 related kinase; MGC34538; OTTHUMP00000031340; OTTHUMP00000031341; OTTHUMP00000031342; OTTHUMP00000031343; OTTHUMP00000031344; OTTHUMP00000031345; OTTHUMP00000166071; OTTHUMP00000166072; PPP1R47; Protein phosphatase 1, regulatory subunit 47; Serine/threonine kinase 15; Serine/threonine kinase 6; Serine/threonine protein kinase 15; Serine/threonine-protein kinase 15; Serine/threonine-protein kinase 6; Serine/threonine-protein kinase aurora-A; STK15; STK6; STK6_HUMAN; STK7
Target Background
The protein encoded by this gene is a cell cycle-regulated kinase that appears to be involved in microtubule formation and/or stabilization at the spindle pole during chromosome segregation. The encoded protein is found at the centrosome in interphase cells and at the spindle poles in mitosis. This gene may play a role in tumor development and progression. A processed pseudogene of this gene has been found on chromosome 1, and an unprocessed pseudogene has been found on chromosome 10. Multiple transcript variants encoding the same protein have been found for this gene.
Notification