Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AVEN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 203-362 of human AVEN (NP_065104.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AVEN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 203-362 of human AVEN (NP_065104.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09559A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AVEN |
| Target Synonyms | PDCD12; AVEN | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 22Rv1, HT-29, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 203-362 of human AVEN (NP_065104.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS | Uniprot ID | Q9NQS1 |
Uniprot Id
Q9NQS1
Target Species
Human
Target Name
AVEN
Target Full Name
Cell death regulator Aven
Target Function
Protects against apoptosis mediated by Apaf-1.
Target Subcellular Location
Endomembrane system; Peripheral membrane protein. Note=Associated with intracellular membranes.
Target Tissue Specificity
Highly expressed in testis, ovary, thymus, prostate, spleen, small intestine, colon, heart, skeletal muscle, liver, kidney and pancreas.
Target Synonyms
1700013A01Rik; 1700056A21Rik; Apoptosis caspase activation inhibitor; AVEN; AVEN_HUMAN; Cell death regulator Aven; mAven L; mAven S; MGC124011; OTTMUSP00000016129; PDCD12; Programmed cell death 12; RP23-52C15.2
Target Background
Involved in negative regulation of apoptotic process. Located in membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
