Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against B3GNT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 165-305 of human B3GNT4 (NP_110392.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against B3GNT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 165-305 of human B3GNT4 (NP_110392.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04760A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | B3GNT4 |
| Target Synonyms | B3GN-T4; beta3Gn-T4; B3GNT4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Rat intestine | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 165-305 of human B3GNT4 (NP_110392.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APPAQLLAYESREFDDILQWDFTEDFFNLTLKELHLQRWVVAACPQAHFMLKGDDDVFVHVPNVLEFLDGWDPAQDLLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGGYVMSRATVRRLQAIMEDAELFPIDD | Uniprot ID | Q9C0J1 |
Uniprot Id
Q9C0J1
Target Species
Human
Target Name
B3GNT4
Target Full Name
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4
Target Function
Beta-1,3-N-acetylglucosaminyltransferase involved in the synthesis of poly-N-acetyllactosamine. Has activity for type 2 oligosaccharides.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 31 family
Target Tissue Specificity
Mainly expressed in brain tissues such as whole brain, hippocampus, amygdala, cerebellum and caudate nucleus. Also expressed in colon, esophagus and kidney.
Target Synonyms
B3GNT4; UNQ1898/PRO4344N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4; EC 2.4.1.149; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4; BGnT-4; Beta-1,3-Gn-T4; Beta-1,3-N-acetylglucosaminyltransferase 4; Beta3Gn-T4
Target Background
This gene encodes a member of the beta-1, 3-N-acetylglucosaminyltransferase protein family. The encoded enzyme is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
