-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BAG3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-575 of human BAG3 (NP_004272.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against BAG3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-575 of human BAG3 (NP_004272.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11406A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BAG3 |
| Target Synonyms | BIS; MFM6; BAG-3; CAIR-1; BAG3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, HepG2, Mouse brain, Mouse testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 380-575 of human BAG3 (NP_004272.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHPGVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP | Uniprot ID | O95817 |
Uniprot Id
O95817
Target Species
Human
Target Name
BAG3
Target Full Name
BAG family molecular chaperone regulator 3
Target Function
Co-chaperone for HSP70 and HSC70 chaperone proteins. Acts as a nucleotide-exchange factor (NEF) promoting the release of ADP from the HSP70 and HSC70 proteins thereby triggering client/substrate protein release. Nucleotide release is mediated via its binding to the nucleotide-binding domain (NBD) of HSPA8/HSC70 where as the substrate release is mediated via its binding to the substrate-binding domain (SBD) of HSPA8/HSC70. Has anti-apoptotic activity. Plays a role in the HSF1 nucleocytoplasmic transport.
Target Involvement
Myopathy, myofibrillar, 6 (MFM6); Cardiomyopathy, dilated 1HH (CMD1HH)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Synonyms
BAG 3; BAG family molecular chaperone regulator 3; BAG-3; Bag3; BAG3_HUMAN; Bcl 2 binding protein; Bcl-2-associated athanogene 3; Bcl-2-binding protein Bis; BCL2 associated athanogene 3; BCL2 binding athanogene 3; BIS; CAIR 1; Docking protein CAIR 1; Docking protein CAIR-1; MFM6
Target Background
BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner.
Notification