Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BCL2L12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human BCL2L12 (Q9HB09) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against BCL2L12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human BCL2L12 (Q9HB09) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-14276A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BCL2L12 |
| Form | Liquid | Species Reactivity | Human |
| Isotype | IgG | Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | MCF7, PC-3 |
| Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human BCL2L12 (Q9HB09). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGL | Uniprot ID | Q9HB09 |
Uniprot Id
Q9HB09
Target Species
Human
Target Name
BCL2L12
Target Full Name
Bcl-2-like protein 12
Target Synonyms
B2L12_HUMAN; BCL 2 like 12 (proline rich); BCL 2 like 12; BCL 2 like 12 isoform 1; Bcl 2 like 12 protein; Bcl 2 related proline rich protein; Bcl-2-like protein 12; Bcl-2-related proline-rich protein; BCL2 like 12 (proline rich); BCL2 like 12; BCL2 like 12 isoform 1; Bcl2 like 12 protein; Bcl2 related proline rich protein; Bcl2-L-12; BCL2L12; BPR; MGC120313; MGC120314; MGC120315
Target Background
This gene encodes a member of a family of proteins containing a Bcl-2 homology domain 2 (BH2). The encoded protein is an anti-apoptotic factor that acts as an inhibitor of caspases 3 and 7 in the cytoplasm. In the nucleus, it binds to the p53 tumor suppressor protein, preventing its association with target genes. Overexpression of this gene has been detected in a number of different cancers. There is a pseudogene for this gene on chromosome 3. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
