-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BCL6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human BCL6(NP_001124317.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, FC, ELISA.
The antibody against BCL6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human BCL6(NP_001124317.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, FC, ELISA.
| Cat.No | ADA-14970A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BCL6 |
| Target Synonyms | BCL5; LAZ3; BCL6A; ZNF51; ZBTB27; BCL6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, FC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human BCL6(NP_001124317.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG | Uniprot ID | P41182 |
Uniprot Id
P41182
Target Species
Human
Target Name
BCL6
Target Full Name
B-cell lymphoma 6 protein
Target Function
Transcriptional repressor mainly required for germinal center (GC) formation and antibody affinity maturation which has different mechanisms of action specific to the lineage and biological functions. Forms complexes with different corepressors and histone deacetylases to repress the transcriptional expression of different subsets of target genes. Represses its target genes by binding directly to the DNA sequence 5'-TTCCTAGAA-3' (BCL6-binding site) or indirectly by repressing the transcriptional activity of transcription factors. In GC B-cells, represses genes that function in differentiation, inflammation, apoptosis and cell cycle control, also autoregulates its transcriptional expression and up-regulates, indirectly, the expression of some genes important for GC reactions, such as AICDA, through the repression of microRNAs expression, like miR155. An important function is to allow GC B-cells to proliferate very rapidly in response to T-cell dependent antigens and tolerate the physiological DNA breaks required for immunglobulin class switch recombination and somatic hypermutation without inducing a p53/TP53-dependent apoptotic response. In follicular helper CD4(+) T-cells (T(FH) cells), promotes the expression of T(FH)-related genes but inhibits the differentiation of T(H)1, T(H)2 and T(H)17 cells. Also required for the establishment and maintenance of immunological memory for both T- and B-cells. Suppresses macrophage proliferation through competition with STAT5 for STAT-binding motifs binding on certain target genes, such as CCL2 and CCND2. In response to genotoxic stress, controls cell cycle arrest in GC B-cells in both p53/TP53-dependedent and -independent manners. Besides, also controls neurogenesis through the alteration of the composition of NOTCH-dependent transcriptional complexes at selective NOTCH targets, such as HES5, including the recruitment of the deacetylase SIRT1 and resulting in an epigenetic silencing leading to neuronal differentiation.
Target Involvement
Chromosomal aberrations involving BCL6 are a cause of B-cell non-Hodgkin lymphomas (B-cell NHL), including diffuse large B-cell lymphoma and follicular lymphoma. Approximately 40% of diffuse large B-cell lymphomas and 5 to 10% of follicular lymphomas are associated with chromosomal translocations that deregulate expression of BCL6 by juxtaposing heterologous promoters to the BCL6 coding domain. Translocation t(3;14)(q27;q32). Translocation t(3;22)(q27;q11) with immunoglobulin gene regions. Translocation t(3;7)(q27;p12) with IKZF1 gene 5'non-coding region. Translocation t(3;6)(q27;p21) with Histone H4. Translocation t(3;16)(q27;p11) with IL21R. Translocation t(3;13)(q27;q14) with LCP1.; DISEASE: Note=A chromosomal aberration involving BCL6 may be a cause of a form of B-cell leukemia. Translocation t(3;11)(q27;q23) with POU2AF1/OBF1.; DISEASE: Note=A chromosomal aberration involving BCL6 may be a cause of lymphoma. Translocation t(3;4)(q27;p11) with ARHH/TTF.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in germinal center T- and B-cells and in primary immature dendritic cells.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
B cell CLL/lymphoma 6; B cell lymphoma 6 protein; B-cell lymphoma 5 protein; B-cell lymphoma 6 protein; BCL 5; Bcl 6; BCL-5; BCL-6; BCL5; BCL6; BCL6_HUMAN; BCL6A; cys his2 zinc finger transcription factor; cys-his2 zinc finger transcription factor; LAZ 3; LAZ 3 protein; LAZ3; Lymphoma Associated Zinc Finger Gene On Chromosome 3 (LAZ3); Lymphoma associated zinc finger gene on chromosome 3; Protein LAZ-3; ZBTB 27; ZBTB27; Zinc finger and BTB domain containing protein 27; Zinc finger and BTB domain-containing protein 27 (ZBTB27); Zinc finger and BTB domain-containing protein 27; Zinc Finger Protein 51 (ZNF51); Zinc finger protein 51; zinc finger transcription factor BCL6S; ZNF 51; ZNF51
Target Background
The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
Notification