Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BDKRB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human BDKRB1 (NP_000701.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BDKRB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human BDKRB1 (NP_000701.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09929A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BDKRB1 |
| Target Synonyms | B1R; BKR1; B1BKR; BKB1R; BRADYB1; BDKRB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, A-549 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BDKRB1 (NP_000701.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLLVFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQ | Uniprot ID | P46663 |
Uniprot Id
P46663
Target Species
Human
Target Name
BDKRB1
Target Full Name
B1 bradykinin receptor
Target Function
This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB1 sub-subfamily
Target Synonyms
BDKRB1; BRADYB1; B1 bradykinin receptor; B1R; BK-1 receptor
Target Background
Bradykinin, a 9 aa peptide, is generated in pathophysiologic conditions such as inflammation, trauma, burns, shock, and allergy. The protein encoded by this gene belongs to the G-protein coupled receptor 1 family. Two types of G-protein coupled receptors have been found which bind bradykinin and mediate responses to these pathophysiologic conditions. The protein encoded by this gene is one of these receptors and is synthesized de novo following tissue injury. Receptor binding leads to an increase in the cytosolic calcium ion concentration, ultimately resulting in chronic and acute inflammatory responses.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
