Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BET1L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human BET1L (NP_057610.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BET1L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human BET1L (NP_057610.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10993A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BET1L |
| Target Synonyms | GS15; BET1L1; GOLIM3; HSPC197; BET1L | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human BET1L (NP_057610.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAH | Uniprot ID | Q9NYM9 |
Uniprot Id
Q9NYM9
Target Species
Human
Target Name
BET1L
Target Full Name
BET1-like protein
Target Function
Vesicle SNARE required for targeting and fusion of retrograde transport vesicles with the Golgi complex. Required for the integrity of the Golgi complex.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type IV membrane protein. Golgi apparatus, trans-Golgi network membrane.
Target Synonyms
BET1-like protein; BET1L; BET1L_HUMAN; Golgi SNARE with a size of 15 kDa; GOLIM3; GOS-15; GS15; Vesicle transport protein GOS15
Target Background
Enables SNAP receptor activity. Involved in regulation of retrograde vesicle-mediated transport, Golgi to ER and retrograde transport, endosome to Golgi. Located in Golgi apparatus and endosome. Implicated in uterine fibroid. Biomarker of endometrial adenocarcinoma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
