-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BLOC1S1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-153 of human BLOC1S1 (NP_001478.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BLOC1S1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-153 of human BLOC1S1 (NP_001478.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09410A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BLOC1S1 |
| Target Synonyms | RT14; BLOS1; MICoA; BORCS1; GCN5L1; BLOC1S1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-153 of human BLOC1S1 (NP_001478.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS | Uniprot ID | P78537 |
Uniprot Id
P78537
Target Species
Human
Target Name
BLOC1S1
Target Full Name
Biogenesis of lysosome-related organelles complex 1 subunit 1
Target Function
Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor.; May negatively regulate aerobic respiration through mitochondrial protein lysine-acetylation. May counteract the action of the deacetylase SIRT3 by acetylating and regulating proteins of the mitochondrial respiratory chain including ATP5F1A and NDUFA9.
Target Subcellular Location
Mitochondrion intermembrane space. Mitochondrion matrix. Cytoplasm, cytosol. Lysosome membrane.
Target Protein Families
BLOC1S1 family
Target Synonyms
BLOC1S1; BLOS1; GCN5L1; RT14Biogenesis of lysosome-related organelles complex 1 subunit 1; BLOC-1 subunit 1; GCN5-like protein 1; Protein RT14
Target Background
BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).
Notification