Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BRD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 301-400 of human BRD2 (NP_005095.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against BRD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 301-400 of human BRD2 (NP_005095.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08710A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BRD2 |
| Target Synonyms | FSH; NAT; RNF3; FSRG1; RING3; FSHRG1; D6S113E; O27.1.1; BRD2-IT1; BRD2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 301-400 of human BRD2 (NP_005095.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVK | Uniprot ID | P25440 |
Uniprot Id
P25440
Target Species
Human
Target Name
BRD2
Target Full Name
Bromodomain-containing protein 2
Target Function
May play a role in spermatogenesis or folliculogenesis. Binds hyperacetylated chromatin and plays a role in the regulation of transcription, probably by chromatin remodeling. Regulates transcription of the CCND1 gene. Plays a role in nucleosome assembly.
Target Subcellular Location
Nucleus. Note=Detected on chromatin and nucleosomes.
Target Research Area
Cell Biology
Target Synonyms
BRD 2; Brd2; BRD2_HUMAN; Bromodomain containing 2; Bromodomain-containing protein 2; D6S113E; DKFZp686N0336; Female sterile homeotic related gene 1; Female sterile homeotic related gene 1; mouse; homolog of; FLJ31942; FSH; FSRG1; KIAA9001; NAT; O27.1.1; Really interesting new gene 3 protein; RING3; RING3 PROTEIN; RNF3
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
