-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against c-Fos was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human c-Fos (NP_005243.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against c-Fos was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human c-Fos (NP_005243.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09881A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | c-Fos |
| Target Synonyms | p55; AP-1; C-FOS; c-Fos | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human c-Fos (NP_005243.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKT | Uniprot ID | P01100 |
Uniprot Id
P01100
Target Species
Human
Target Name
FOS
Target Full Name
Protein c-Fos
Target Function
Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum.
Target Subcellular Location
Nucleus. Endoplasmic reticulum. Cytoplasm, cytosol. Note=In quiescent cells, present in very small amounts in the cytosol. Following induction of cell growth, first localizes to the endoplasmic reticulum and only later to the nucleus. Localization at the endoplasmic reticulum requires dephosphorylation at Tyr-10 and Tyr-30.
Target Protein Families
BZIP family, Fos subfamily
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Activator protein 1; AP 1; C FOS; Cellular oncogene c fos; Cellular oncogene fos; FBJ murine osteosarcoma viral (v fos) oncogene homolog (oncogene FOS); FBJ murine osteosarcoma viral oncogene homolog; FBJ murine osteosarcoma viral v fos oncogene homolog ; FBJ Osteosarcoma Virus; FOS; FOS protein; FOS_HUMAN; G0 G1 switch regulatory protein 7; G0/G1 switch regulatory protein 7; G0S7; Oncogene FOS; p55; proto oncogene c Fos; Proto oncogene protein c fos; Proto-oncogene c-Fos; v fos FBJ murine osteosarcoma viral oncogene homolog
Target Background
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.
Notification