-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C10orf2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 585-684 of human C10orf2 (NP_068602.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against C10orf2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 585-684 of human C10orf2 (NP_068602.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06249A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C10orf2 |
| Target Synonyms | PEO; PEO1; SCA8; ATXN8; IOSCA; PEOA3; SANDO; TWINL; MTDPS7; PRLTS5; C10orf2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 585-684 of human C10orf2 (NP_068602.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NVLILQDRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPDTSKRSK | Uniprot ID | Q96RR1 |
Uniprot Id
Q96RR1
Target Species
Human
Target Name
TWNK
Target Full Name
Twinkle mtDNA helicase
Target Function
Mitochondrial helicase involved in mtDNA replication and repair. Might have a role in mtDNA repair. Has DNA strand separation activity needed to form a processive replication fork for leading strand synthesis which is catalyzed by the formation of a replisome complex with POLG and mtSDB. Preferentially unwinds DNA substrates with pre-existing 5'-and 3'- single-stranded tails but is also active on a 5'- flap substrate. Can dissociate the invading strand of immobile or mobile D-loop DNA structures irrespective of the single strand polarity of the third strand. In addition to its DNA strand separation activity, also has DNA strand annealing, DNA strand-exchange and DNA branch migration activities.; Lack DNA unwinding and ATP hydrolysis activities. Does not bind single-stranded or double-stranded DNA.
Target Involvement
Progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal dominant, 3 (PEOA3); Mitochondrial DNA depletion syndrome 7 (MTDPS7); Perrault syndrome 5 (PRLTS5)
Target Subcellular Location
Mitochondrion matrix, mitochondrion nucleoid.
Target Tissue Specificity
High relative levels in skeletal muscle, testis and pancreas. Lower levels of expression in the heart, brain, placenta, lung, liver, kidney, spleen, thymus, prostate, ovary, small intestine, colon and leukocytes. Expression is coregulated with MRPL43.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Ataxin 8; Ataxin8; ATXN 8; ATXN8; C10 orf2 ; C10orf 2 ; C10orf2; Chromosome 10 open reading frame 2; IOSCA; mitochondrial; MTDPS7; PEO 1; PEO; PEO1; PEO1_HUMAN; PEOA3; Progressive external ophthalmoplegia 1 protein; SANDO; SCA 8; SCA8; T7 gp4 like protein with intramitochondrial nucleoid localization; T7 gp4-like protein with intramitochondrial nucleoid localization; T7 helicase-related protein with intramitochondrial nucleoid localization; T7 like mitochondrial DNA helicase; T7-like mitochondrial DNA helicase; Twinkle protein; Twinkle protein, mitochondrial; TWINL
Target Background
This gene encodes a hexameric DNA helicase which unwinds short stretches of double-stranded DNA in the 5' to 3' direction and, along with mitochondrial single-stranded DNA binding protein and mtDNA polymerase gamma, is thought to play a key role in mtDNA replication. The protein localizes to the mitochondrial matrix and mitochondrial nucleoids. Mutations in this gene cause infantile onset spinocerebellar ataxia (IOSCA) and progressive external ophthalmoplegia (PEO) and are also associated with several mitochondrial depletion syndromes. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification