Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C1S was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human C1S (NP_001725.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against C1S was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human C1S (NP_001725.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03560A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C1S |
| Target Synonyms | EDSPD2; C1S | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human C1S (NP_001725.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FIGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPY | Uniprot ID | P09871 |
Uniprot Id
P09871
Target Species
Human
Target Name
C1S
Target Full Name
Complement C1s subcomponent
Target Function
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Target Involvement
Complement component C1s deficiency (C1SD); Ehlers-Danlos syndrome, periodontal type, 2 (EDSPD2)
Target Protein Families
Peptidase S1 family
Target Research Area
Immunology
Target Synonyms
Basic proline rich peptide IB 1; C1 esterase; C1S; C1S_HUMAN; Complement C1s subcomponent ; Complement C1s subcomponent heavy chain; Complement C1s subcomponent light chain; Complement component 1 s subcomponent; Complement component 1 subcomponent s; FLJ44757
Target Background
This gene encodes a serine protease, which is a major constituent of the human complement subcomponent C1. C1s associates with two other complement components C1r and C1q in order to yield the first component of the serum complement system. Defects in this gene are the cause of selective C1s deficiency.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
