-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CACNG7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 156-275 of human CACNG7 (NP_114102.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CACNG7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 156-275 of human CACNG7 (NP_114102.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01832A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CACNG7 |
| Target Synonyms | CACNG7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 156-275 of human CACNG7 (NP_114102.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | INDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC | Uniprot ID | P62955 |
Uniprot Id
P62955
Target Species
Human
Target Name
CACNG7
Target Full Name
Voltage-dependent calcium channel gamma-7 subunit
Target Function
Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit. Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Displays subunit-specific AMPA receptor regulation. Shows specificity only for GRIA1 and GRIA2.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Target Tissue Specificity
Detected in heart left ventricle. Widely expressed.
Target Synonyms
CACNG7; Voltage-dependent calcium channel gamma-7 subunit; Neuronal voltage-gated calcium channel gamma-7 subunit; Transmembrane AMPAR regulatory protein gamma-7; TARP gamma-7
Target Background
The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type I TARP and a calcium channel gamma subunit.
Notification