-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CaMKI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human CaMKI (NP_003647.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CaMKI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human CaMKI (NP_003647.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05603A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CaMKI |
| Target Synonyms | CAMKI; CaMKI | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human CaMKI (NP_003647.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYL | Uniprot ID | Q14012 |
Uniprot Id
Q14012
Target Species
Human
Target Name
CAMK1
Target Full Name
Calcium/calmodulin-dependent protein kinase type 1
Target Function
Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, regulates transcription activators activity, cell cycle, hormone production, cell differentiation, actin filament organization and neurite outgrowth. Recognizes the substrate consensus sequence [MVLIF]-x-R-x(2)-[ST]-x(3)-[MVLIF]. Regulates axonal extension and growth cone motility in hippocampal and cerebellar nerve cells. Upon NMDA receptor-mediated Ca(2+) elevation, promotes dendritic growth in hippocampal neurons and is essential in synapses for full long-term potentiation (LTP) and ERK2-dependent translational activation. Downstream of NMDA receptors, promotes the formation of spines and synapses in hippocampal neurons by phosphorylating ARHGEF7/BETAPIX on 'Ser-694', which results in the enhancement of ARHGEF7 activity and activation of RAC1. Promotes neuronal differentiation and neurite outgrowth by activation and phosphorylation of MARK2 on 'Ser-91', 'Ser-92', 'Ser-93' and 'Ser-294'. Promotes nuclear export of HDAC5 and binding to 14-3-3 by phosphorylation of 'Ser-259' and 'Ser-498' in the regulation of muscle cell differentiation. Regulates NUMB-mediated endocytosis by phosphorylation of NUMB on 'Ser-276' and 'Ser-295'. Involved in the regulation of basal and estrogen-stimulated migration of medulloblastoma cells through ARHGEF7/BETAPIX phosphorylation. Is required for proper activation of cyclin-D1/CDK4 complex during G1 progression in diploid fibroblasts. Plays a role in K(+) and ANG2-mediated regulation of the aldosterone synthase (CYP11B2) to produce aldosterone in the adrenal cortex. Phosphorylates EIF4G3/eIF4GII. In vitro phosphorylates CREB1, ATF1, CFTR, MYL9 and SYN1/synapsin I.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Target Tissue Specificity
Widely expressed. Expressed in cells of the zona glomerulosa of the adrenal cortex.
Target Synonyms
Calcium / calmodulin dependent protein kinase 1; Calcium / calmodulin dependent protein kinase I; Calcium / calmodulin dependent protein kinase type 1; Calcium/calmodulin dependent protein kinase 1; Calcium/calmodulin dependent protein kinase I; Calcium/calmodulin dependent protein kinase type 1; Calcium/calmodulin-dependent protein kinase type 1; CaM K1; CaM KI; CaM kinase 1 alpha; CAM kinase 1; CaM kinase I alpha; CaM kinase I; CaM-KI; CaMK 1; CAMK I; CaMK1 alpha; CAMK1; CAMK1 PEN; CaMKI alpha; CaMKI-alpha; KCC1A_HUMAN; MGC120317; MGC120318
Target Background
Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase.
Notification