-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CAMKK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CAMKK2 (NP_006540.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CAMKK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CAMKK2 (NP_006540.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11995A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CAMKK2 |
| Target Synonyms | CAMKK; CAMKKB; CAMKK2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, LNCaP, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CAMKK2 (NP_006540.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLS | Uniprot ID | Q96RR4 |
Uniprot Id
Q96RR4
Target Species
Human
Target Name
CAMKK2
Target Full Name
Calcium/calmodulin-dependent protein kinase kinase 2
Target Function
Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. Efficiently phosphorylates 5'-AMP-activated protein kinase (AMPK) trimer, including that consisting of PRKAA1, PRKAB1 and PRKAG1. This phosphorylation is stimulated in response to Ca(2+) signals. Seems to be involved in hippocampal activation of CREB1. May play a role in neurite growth. Isoform 3 may promote neurite elongation, while isoform 1 may promoter neurite branching.
Target Subcellular Location
Nucleus. Cytoplasm. Cell projection, neuron projection.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Target Tissue Specificity
Ubiquitously expressed with higher levels in the brain. Intermediate levels are detected in spleen, prostate, thyroid and leukocytes. The lowest level is in lung.
Target Synonyms
Calcium/calmodulin dependent protein kinase beta ; Calcium/calmodulin dependent protein kinase kinase 2; Calcium/calmodulin dependent protein kinase kinase 2 beta; Calcium/calmodulin dependent protein kinase kinase beta ; Calcium/calmodulin-dependent protein kinase kinase 2; Calcium/calmodulin-dependent protein kinase kinase beta; CaM kinase kinase beta; CaM KK beta; CaM-kinase kinase 2; CaM-kinase kinase beta; CaM-KK 2; CaM-KK beta; CaMKK 2; CAMKK; CaMKK beta; CAMKK beta protein; Camkk2; CAMKKB; KKCC2_HUMAN
Target Background
The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases.
Notification