-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CAMLG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human CAMLG (NP_001736.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CAMLG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human CAMLG (NP_001736.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-06088A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CAMLG |
| Target Synonyms | CAML; GET2; CDG2Z; CAMLG | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, HT-29, Mouse testis, Mouse thymus, Rat thymus, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human CAMLG (NP_001736.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRI | Uniprot ID | P49069 |
Uniprot Id
P49069
Target Species
Human
Target Name
CAMLG
Target Full Name
Guided entry of tail-anchored proteins factor CAMLG
Target Function
Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Together with GET1/WRB, acts as a membrane receptor for soluble GET3/TRC40, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. Required for the stability of GET1. Stimulates calcium signaling in T cells through its involvement in elevation of intracellular calcium. Essential for the survival of peripheral follicular B cells.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Tissue Specificity
Ubiquitous. Highest levels in brain, testis and ovary.
Target Synonyms
CAMLG; CAML; Calcium signal-modulating cyclophilin ligand; CAML
Target Background
The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin.
Notification