Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CARD10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 863-1032 of human CARD10 (NP_055365.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CARD10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 863-1032 of human CARD10 (NP_055365.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09337A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CARD10 |
| Target Synonyms | BIMP1; IMD89; CARMA3; CARD10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 863-1032 of human CARD10 (NP_055365.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLDLPSSRLDFQVCPAESLSGEELCPSSAPGAPKAQPATPGLGSRIRAIQESVGKKHCLLELGARGVRELVQNEIYPIVIHVEVTEKNVREVRGLLGRPGWRDSELLRQCRGSEQVLWGLPCSWVQVPAHEWGHAEELAKVVRGRILQEQARLVWVECGSSRGCPSSSEA | Uniprot ID | Q9BWT7 |
Uniprot Id
Q9BWT7
Target Species
Human
Target Name
CARD10
Target Full Name
Caspase recruitment domain-containing protein 10
Target Function
Activates NF-kappa-B via BCL10 and IKK.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Detected in adult heart, kidney and liver; lower levels in intestine, placenta, muscle and lung. Also found in fetal lung, liver and kidney.
Target Synonyms
Bcl10 binding protein and activator of NFKB; BIMP1; CAR10_HUMAN; CARD 10; CARD containing MAGUK 3 protein; CARD-containing MAGUK 3; CARD-containing MAGUK protein 3; CARD10; Carma 3; CARMA3; Caspase Recruitment Domain family member 10; Caspase recruitment domain-containing protein 10
Target Background
The caspase recruitment domain (CARD) is a protein module that consists of 6 or 7 antiparallel alpha helices. It participates in apoptosis signaling through highly specific protein-protein homophilic interactions. Like several other CARD proteins, CARD10 belongs to the membrane-associated guanylate kinase (MAGUK) family and activates NF-kappa-B (NFKB; see MIM 164011) through BCL10 (MIM 603517) (Wang et al., 2001 [PubMed 11259443]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
