-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Caspr1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human Caspr11 (P78357) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Caspr1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human Caspr11 (P78357) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14298A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Caspr1 |
| Target Synonyms | CHN3; P190; CASPR; NRXN4; CNTNAP; Caspr1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Caspr11 (P78357). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EQHFYWGGSQPGIQRCACGLDRSCVDPALYCNCDADQPQWRTDKGLLTFVDHLPVTQVVIGDTNRSTSEAQFFLRPLRCYGDRNSWNTISFHTGAALRFPP | Uniprot ID | P78357 |
Uniprot Id
P78357
Target Species
Human
Target Name
CNTNAP1
Target Full Name
Contactin-associated protein 1
Target Function
Required, with CNTNAP2, for radial and longitudinal organization of myelinated axons. Plays a role in the formation of functional distinct domains critical for saltatory conduction of nerve impulses in myelinated nerve fibers. Demarcates the paranodal region of the axo-glial junction. In association with contactin involved in the signaling between axons and myelinating glial cells.
Target Involvement
Lethal congenital contracture syndrome 7 (LCCS7)
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Cell junction, paranodal septate junction.
Target Protein Families
Neurexin family
Target Tissue Specificity
Predominantly expressed in brain. Weak expression detected in ovary, pancreas, colon, lung, heart, intestine and testis.
Target Research Area
Neuroscience
Target Synonyms
Caspr; Caspr1; CNTNAP; Cntnap1; CNTP1_HUMAN; Contactin associated protein 1; Contactin-associated protein 1; MHDNIV; NCP1; Neurexin 4; Neurexin IV; Neurexin-4; Nrxn4; p190; Paranodin
Target Background
The gene product was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex. The 1, 384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein, ' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain. Northern blot analysis showed that the gene is transcribed predominantly in brain as a transcript of 6.2 kb, with weak expression in several other tissues tested. The architecture of its extracellular domain is similar to that of neurexins, and this protein may be the signaling subunit of contactin, enabling recruitment and activation of intracellular signaling pathways in neurons.
Notification