-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cation-independent M6PR (IGF2R) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2140-2300 of human Cation-independent M6PR (IGF2R) (NP_000867.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Cation-independent M6PR (IGF2R) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2140-2300 of human Cation-independent M6PR (IGF2R) (NP_000867.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14882A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cation-independent M6PR (IGF2R) |
| Target Synonyms | MPR1; MPRI; CD222; CIMPR; M6P-R; MPR300; CI-M6PR; MPR 300; M6P/IGF2R; Cation-independent M6PR (IGF2R) | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549(negative), HepG2, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2140-2300 of human Cation-independent M6PR (IGF2R) (NP_000867.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TNPINGKSFSLGDIYFKLFRASGDMRTNGDNYLYEIQLSSITSSRNPACSGANICQVKPNDQHFSRKVGTSDKTKYYLQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVEDGIPEFSHETADCQYLFSWYTSAVCPLGVGFDSENPGDDGQMHKGLS | Uniprot ID | P11717 |
Uniprot Id
P11717
Target Species
Human
Target Name
IGF2R
Target Full Name
Cation-independent mannose-6-phosphate receptor
Target Function
Mediates the transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex. The receptor is then recycled back to the Golgi for another round of trafficking through its binding to the retromer. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation by binding DPP4.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein.
Target Protein Families
MRL1/IGF2R family
Target Research Area
Transport
Target Synonyms
300 kDa mannose 6 phosphate receptor; 300 kDa mannose 6-phosphate receptor; Cation independent mannose 6 phosphate receptor; Cation-independent mannose-6-phosphate receptor; CD222; CD222 antigen; CI Man 6 P receptor; CI Man-6-P receptor; CI MPR; CI-M6PR; CI-MPR; CIMPR; IGF 2 receptor; IGF 2R; IGF II receptor; IGF-II receptor; IGF2 receptor; Igf2r; Insulin like growth factor 2 receptor; Insulin like growth factor II receptor; Insulin-like growth factor 2 receptor; Insulin-like growth factor II receptor; M6P R; M6P/IGF2 receptor; M6P/IGF2R; M6PR; mannose 6 phosphate receptor; mannose 6 phosphate receptor, cation independent; MPR 300; MPR300; MPRI; MPRI_HUMAN
Target Background
This gene encodes a receptor for both insulin-like growth factor 2 and mannose 6-phosphate. The binding sites for each ligand are located on different segments of the protein. This receptor has various functions, including in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of insulin-like growth factor 2. Mutation or loss of heterozygosity of this gene has been association with risk of hepatocellular carcinoma. The orthologous mouse gene is imprinted and shows exclusive expression from the maternal allele; however, imprinting of the human gene may be polymorphic, as only a minority of individuals showed biased expression from the maternal allele (PMID:8267611).
Notification