-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Caveolin-2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human CAV2 (NP_001224.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Caveolin-2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human CAV2 (NP_001224.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07497A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Caveolin-2 |
| Target Synonyms | CAV; Caveolin-2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human CAV2 (NP_001224.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHS | Uniprot ID | P51636 |
Uniprot Id
P51636
Target Species
Human
Target Name
CAV2
Target Full Name
Caveolin-2
Target Function
May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression.
Target Subcellular Location
Nucleus. Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein. Membrane, caveola; Peripheral membrane protein.
Target Protein Families
Caveolin family
Target Tissue Specificity
Expressed in endothelial cells, smooth muscle cells, skeletal myoblasts and fibroblasts.
Target Synonyms
CAV; CAV2; CAV2_HUMAN; Caveolae protein 20 kD ; Caveolin 2; Caveolin 2 isoform a and b; Caveolin-2; MGC12294; OTTHUMP00000025032; OTTHUMP00000195982
Target Background
The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. This gene and related family member (CAV1) are located next to each other on chromosome 7, and express colocalizing proteins that form a stable hetero-oligomeric complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Additional isoforms resulting from the use of alternate in-frame translation initiation codons have also been described, and shown to have preferential localization in the cell (PMID:11238462).
Notification