-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CBX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-211 of human CBX2 (NP_116036.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CBX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-211 of human CBX2 (NP_116036.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04292A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CBX2 |
| Target Synonyms | M33; CDCA6; SRXY5; CBX2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BT-474, K-562, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 62-211 of human CBX2 (NP_116036.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EHEKEVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSPPLPGASCFSLSCTPLCWVAGSNCCRQALFPPRGSLGDGKEQEACVQ | Uniprot ID | Q14781 |
Uniprot Id
Q14781
Target Species
Human
Target Name
CBX2
Target Full Name
Chromobox protein homolog 2
Target Function
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Binds to histone H3 trimethylated at 'Lys-9' (H3K9me3) or at 'Lys-27' (H3K27me3). Plays a role in the lineage differentiation of the germ layers in embryonic development. Involved in sexual development, acting as activator of NR5A1 expression.
Target Involvement
46,XY sex reversal 5 (SRXY5)
Target Subcellular Location
Nucleus. Chromosome.
Target Synonyms
Cbx 2; CBX2; CBX2_HUMAN; CDC A6; CDCA6; Cell division cycle associated 6; Cell division cycle associated6; chromobox homolog 2 (Pc class homolog, Drosophila); Chromobox homolog 2; Chromobox homolog2; Chromobox protein homolog 2; hromobox homolog 2; M33; M33 polycomb like; MOD 2; MOD2; Modifier 3; Modifier3; Pc class homolog; Polycomb; SRXY5
Target Background
This gene encodes a component of the polycomb multiprotein complex, which is required to maintain the transcriptionally repressive state of many genes throughout development via chromatin remodeling and modification of histones. Disruption of this gene in mice results in male-to-female gonadal sex reversal. Mutations in this gene are also associated with gonadal dysgenesis in humans. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Notification