-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CC2D1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CC2D1A (NP_060191.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CC2D1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CC2D1A (NP_060191.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03894A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CC2D1A |
| Target Synonyms | Lgd2; MRT3; TAPE; Aki-1; FREUD-1; Freud-1/Aki1; CC2D1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, A-549, LO2, Mouse brain, SKOV3, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CC2D1A (NP_060191.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTA | Uniprot ID | Q6P1N0 |
Uniprot Id
Q6P1N0
Target Species
Human
Target Name
CC2D1A
Target Full Name
Coiled-coil and C2 domain-containing protein 1A
Target Function
Transcription factor that binds specifically to the DRE (dual repressor element) and represses HTR1A gene transcription in neuronal cells. The combination of calcium and ATP specifically inactivates the binding with FRE. May play a role in the altered regulation of HTR1A associated with anxiety and major depression. Mediates HDAC-independent repression of HTR1A promoter in neuronal cell. Performs essential function in controlling functional maturation of synapses. Plays distinct roles depending on its localization. When cytoplasmic, acts as a scaffold protein in the PI3K/PDK1/AKT pathway. Repressor of HTR1A when nuclear. In the centrosome, regulates spindle pole localization of the cohesin subunit SCC1/RAD21, thereby mediating centriole cohesion during mitosis.
Target Involvement
Mental retardation, autosomal recessive 3 (MRT3)
Target Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
CC2D1 family
Target Synonyms
CC2D1A; AKI1Coiled-coil and C2 domain-containing protein 1A; Akt kinase-interacting protein 1; Five prime repressor element under dual repression-binding protein 1; FRE under dual repression-binding protein 1; Freud-1; Putative NF-kappa-B-activating protein 023N
Target Background
This gene encodes a transcriptional repressor that binds to a conserved 14-bp 5'-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA binding and transcriptional repressor activities of the protein are inhibited by calcium. A mutation in this gene results in a nonsyndromic form of cognitive disability (MRT3).
Notification