Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCL3L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-93 of human CCL3L1 (NP_066286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CCL3L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-93 of human CCL3L1 (NP_066286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04255A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCL3L1 |
| Target Synonyms | LD78; 464.2; MIP1AP; SCYA3L; G0S19-2; SCYA3L1; D17S1718; LD78BETA; LD78-beta(1-70); CCL3L1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | B cells | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-93 of human CCL3L1 (NP_066286.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA | Uniprot ID | P16619 |
Uniprot Id
P16619
Target Species
Human
Target Name
CCL3L1
Target Full Name
C-C motif chemokine 3-like 1
Target Function
Chemotactic for lymphocytes and monocytes. Is a ligand for CCR1, CCR3 and CCR5. Is an inhibitor of HIV-1-infection. The processed form LD78-beta(3-70) shows a 20-fold to 30-fold higher chemotactic activity and is a very potent inhibitor of HIV-1-infection. LD78-beta(3-70) is also a ligand for CCR1, CCR3 and CCR5.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine beta (chemokine CC) family
Target Synonyms
464.2; C-C motif chemokine 3-like 1; CCL3L3; CL3L1_HUMAN; D17S1718; G0/G1 switch regulatory protein 19-2; G0S19-2; LD78; LD78-beta(1-70); LD78-beta(5-70); LD78BETA; PAT 464.2; SCYA3L; SCYA3L1; Small-inducible cytokine A3-like 1; Tonsillar lymphocyte LD78 beta protein
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
