Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD23 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 222-321 of human CD23 (P06734) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CD23 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 222-321 of human CD23 (P06734) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13764A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD23 |
| Target Synonyms | CD23; FCE2; CD23A; IGEBF; CLEC4J; FCErII; BLAST-2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 222-321 of human CD23 (P06734). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS | Uniprot ID | P06734 |
Uniprot Id
P06734
Target Species
Human
Target Name
FCER2
Target Full Name
Low affinity immunoglobulin epsilon Fc receptor
Target Function
Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell membrane; Lipid-anchor. Secreted. Note=Also exists as a soluble excreted form, sCD23.
Target Research Area
Immunology
Target Synonyms
Blast 2; BLAST-2; Blast2; C type lectin domain family 4 member J; C-type lectin domain family 4; C-type lectin domain family 4 member J; C-type lectin domain family 4; member J; CD 23; CD 23A; CD23; CD23 antigen; CD23A; CLEC 4J; CLEC4J; Fc epsilon receptor II; Fc epsilon RII; Fc fragment of IgE; Fc fragment of IgE low affinity II receptor for; Fc fragment of IgE receptor II; Fc fragment of IgE; low affinity II; receptor for (CD23); Fc of IgE; Fc of IgE; low affinity II; receptor for (CD23); Fc receptor IgE low affinity II alpha polypeptide; Fc receptor; IgE; low affinity II; alpha polypeptide; isoform CRA_a; Fc-epsilon-RII; FCE 2; FCE2; FCER 2; Fcer2; FCER2_HUMAN; FCER2A; FceRII; IgE binding factor; IgE receptor lymphocyte; IgE-binding factor; IGEBF; Immunoglobulin E binding factor; Immunoglobulin E receptor; Immunoglobulin E receptor; low affinity II; Immunoglobulin E-binding factor; Immunoglobulin epsilon chain; LEUKOCYTE ANTIGEN CD23; Low Affinity IgE Receptor; Low affinity immunoglobulin epsilon Fc receptor; Low affinity immunoglobulin epsilon Fc receptor membrane bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form; Ly-42; Ly42; Lymphocyte antigen CD23; Lymphocyte IgE receptor; MGC93219
Target Background
The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
