-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD244 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 22-221 of human CD244 (Q9BZW8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.
The antibody against CD244 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 22-221 of human CD244 (Q9BZW8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.
| Cat.No | ADA-13216A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD244 |
| Target Synonyms | CD244; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; CD244 molecule | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HEL, KG-1, U937 | Application | ELISA, WB, FC |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 22-221 of human CD244 (Q9BZW8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNA | Uniprot ID | Q9BZW8 |
Uniprot Id
Q9BZW8
Target Species
Human
Target Name
CD244
Target Full Name
Natural killer cell receptor 2B4
Target Function
Heterophilic receptor of the signaling lymphocytic activation molecule (SLAM) family; its ligand is CD48. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Acts as activating natural killer (NK) cell receptor. Activating function implicates association with SH2D1A and FYN. Downstreaming signaling involves predominantly VAV1, and, to a lesser degree, INPP5D/SHIP1 and CBL. Signal attenuation in the absence of SH2D1A is proposed to be dependent on INPP5D and to a lesser extent PTPN6/SHP-1 and PTPN11/SHP-2. Stimulates NK cell cytotoxicity, production of IFN-gamma and granule exocytosis. Optimal expansion and activation of NK cells seems to be dependent on the engagement of CD244 with CD48 expressed on neighboring NK cells. Acts as costimulator in NK activation by enhancing signals by other NK receptors such as NCR3 and NCR1. At early stages of NK cell differentiation may function as an inhibitory receptor possibly ensuring the self-tolerance of developing NK cells. Involved in the regulation of CD8(+) T-cell proliferation; expression on activated T-cells and binding to CD488 provides costimulatory-like function for neighboring T-cells. Inhibits inflammatory responses in dendritic cells (DCs).
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Cell membrane.
Target Tissue Specificity
Expressed in spleen, PBL, followed by lung, liver, testis and small intestine. Expressed in all natural killer (NK) cells, monocytes and basophils, TCR-gamma/delta+ T-cells, monocytes, basophils, and on a subset of CD8(+) T-cells.
Target Research Area
Immunology
Target Synonyms
2B4; C9.1; CD244; CD244 antigen; CD244 molecule; CD244 molecule natural killer cell receptor 2B4 ; CD244 natural killer cell receptor 2B4; CD244_HUMAN; F730046O15Rik; h2B4; Ly90; NAIL; Natural killer cell activation-inducing ligand; Natural killer cell receptor 2B4; NK cell activation inducing ligand; NK cell activation inducing ligand NAIL ; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NKR2B4; Nmrk; Non-MHC restricted killing associated; OTTHUMP00000027884 ; p38; signaling lymphocytic activation molecule 4; SLAM family, member 4; SLAMF4
Target Background
This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification