Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD25 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 101-200 of human CD25 (NP_000408.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, FC, ELISA.
The antibody against CD25 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 101-200 of human CD25 (NP_000408.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, FC, ELISA.
| Cat.No | ADA-09832A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD25 |
| Target Synonyms | p55; CD25; IL2R; IMD41; TCGFR; IDDM10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, Rat spleen | Application | ELISA, WB, FC, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 101-200 of human CD25 (NP_000408.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQ | Uniprot ID | P01589 |
Uniprot Id
P01589
Target Species
Human
Target Name
IL2RA
Target Full Name
Interleukin-2 receptor subunit alpha
Target Function
Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells.
Target Involvement
Diabetes mellitus, insulin-dependent, 10 (IDDM10); Immunodeficiency 41 with lymphoproliferation and autoimmunity (IMD41)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Research Area
Cancer
Target Synonyms
IL2RA; Interleukin-2 receptor subunit alpha; IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA; TAC antigen; p55; CD antigen CD25
Target Background
The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency. Patients with severe Coronavirus Disease 2019 (COVID-19), the disease caused by the novel severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), have significantly elevated levels of IL2R in their plasma. Similarly, serum IL-2R levels are found to be elevated in patients with different types of carcinomas. Certain IL2RA and IL2RB gene polymorphisms have been associated with lung cancer risk.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
