-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD303/BDCA-2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 45-213 of human CD303/BDCA-2 (NP_569708.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.
The antibody against CD303/BDCA-2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 45-213 of human CD303/BDCA-2 (NP_569708.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.
| Cat.No | ADA-15479A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD303/BDCA-2 |
| Target Synonyms | CLEC4C; BDCA2; CD303; CLECSF11; CLECSF7; DLEC; HECL; PRO34150; C-type lectin domain family 4 member C; CD303/BDCA-2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, FC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 45-213 of human CD303/BDCA-2 (NP_569708.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI | Uniprot ID | Q8WTT0 |
Uniprot Id
Q8WTT0
Target Species
Human
Target Name
CLEC4C
Target Full Name
C-type lectin domain family 4 member C
Target Function
Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells. Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Binds to serum IgG. Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Target Tissue Specificity
Expressed in plasmacytoid dendritic cells (PDCs). Constitutively expressed in immature monocyte-derived dendritic cells (iMDDC) and is significantly down-regulated upon maturation with LPS but not with TNF-alpha.
Target Research Area
Immunology
Target Synonyms
CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; UNQ9361/PRO34150C-type lectin domain family 4 member C; Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD antigen CD303
Target Background
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene.
Notification