-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD352/SLAMF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-215 of human CD352/SLAMF6 (NP_001171643.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, FC, ELISA.
The antibody against CD352/SLAMF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-215 of human CD352/SLAMF6 (NP_001171643.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, FC, ELISA.
| Cat.No | ADA-15394A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD352/SLAMF6 |
| Target Synonyms | SLAMF6; CD352; KALI; KALIb; Ly108; NTB-A; NTBA; SF2000; SLAM family member 6; CD352/SLAMF6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Daudi, Ramos | Application | ELISA, WB, FC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-215 of human CD352/SLAMF6 (NP_001171643.1) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCE | Uniprot ID | Q96DU3 |
Uniprot Id
Q96DU3
Target Species
Human
Target Name
SLAMF6
Target Full Name
SLAM family member 6
Target Function
Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors. Positive signaling in NK cells implicates phosphorylation of VAV1. NK cell activation seems to depend on SH2D1B and not on SH2D1A. In conjunction with SLAMF1 controls the transition between positive selection and the subsequent expansion and differentiation of the thymocytic natural killer T (NKT) cell lineage. Promotes T-cell differentiation into a helper T-cell Th17 phenotype leading to increased IL-17 secretion; the costimulatory activity requires SH2D1A. Promotes recruitment of RORC to the IL-17 promoter. In conjunction with SLAMF1 and CD84/SLAMF5 may be a negative regulator of the humoral immune response. In the absence of SH2D1A/SAP can transmit negative signals to CD4(+) T-cells and NKT cells. Negatively regulates germinal center formation by inhibiting T-cell:B-cell adhesion; the function probably implicates increased association with PTPN6/SHP-1 via ITSMs in absence of SH2D1A/SAP. However, reported to be involved in maintaining B-cell tolerance in germinal centers and in preventing autoimmunity.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed by all (resting and activated) natural killer cells (NK), T- and B-lymphocytes. Increased surface expression on T-cells of systemic lupus erythematosus (SLE) patients.
Target Research Area
Immunology
Target Synonyms
Activating NK receptor; CD352; KALI; KALIb; LY108; MGC104953; Natural killer T and B cell antigen; NK T B antigen; NK-; T-; and B-cell antigen; NK-T-B-antigen; NTB A; NTB-A; NTBA; NTBA receptor; SF2000; SLAF6_HUMAN; SLAM family member 6; SLAM family member 6 precursor ; SLAM Family Receptor; Slamf6
Target Background
The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It functions as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification