Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD5 (P06127) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CD5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD5 (P06127) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15843A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD5 |
| Target Synonyms | T1; LEU1; CD5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD5 (P06127). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYT | Uniprot ID | P06127 |
Uniprot Id
P06127
Target Species
Human
Target Name
CD5
Target Full Name
T-cell surface glycoprotein CD5
Target Function
May act as a receptor in regulating T-cell proliferation.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Synonyms
CD5; LEU1; T-cell surface glycoprotein CD5; Lymphocyte antigen T1/Leu-1; CD antigen CD5
Target Background
This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
