-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD55 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD55 (P08174) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD55 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD55 (P08174) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16457A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD55 |
| Target Synonyms | CR; TC; DAF; CROM; CHAPLE; CD55 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD55 (P08174). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLK | Uniprot ID | P08174 |
Uniprot Id
P08174
Target Species
Human
Target Name
CD55
Target Full Name
Complement decay-accelerating factor
Target Function
This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage.; (Microbial infection) Acts as a receptor for Coxsackievirus A21, coxsackieviruses B1, B3 and B5.; (Microbial infection) Acts as a receptor for Human enterovirus 70 and D68 (Probable).; (Microbial infection) Acts as a receptor for Human echoviruses 6, 7, 11, 12, 20 and 21.
Target Involvement
Complement hyperactivation, angiopathic thrombosis, and protein-losing enteropathy (CHAPLE)
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cell membrane; Lipid-anchor, GPI-anchor.; [Isoform 3]: Secreted.; [Isoform 4]: Secreted.; [Isoform 5]: Secreted.; [Isoform 6]: Cell membrane; Lipid-anchor, GPI-anchor.; [Isoform 7]: Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Receptors of complement activation (RCA) family
Target Tissue Specificity
Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body flui
Target Research Area
Immunology
Target Synonyms
CD 55; CD55; CD55 antigen; CD55 Cromer blood group system; CD55 molecule (Cromer blood group); CD55 molecule; CD55 molecule; decay accelerating factor for complement (Cromer blood group); Cd55a; Complement decay accelerating factor; Complement decay-accelerating factor; Complement decay-accelerating factor; GPI-anchored; CR; CROM; Cromer Blood Group antigen; Cromer blood group system; DAF; Daf-GPI; DAF_HUMAN; Daf1; Dcay accelerating factor for complement (CD55; Cromer blood group system); Decay accelarating factor 1; isoform CRA_a; Decay accelerating factor (GPI-form); Decay Accelerating Factor for Complement; Decay accelerating factor GPI-form; Decay accelerating factor soluble-form; GPI-DAF; TC
Target Background
This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins.
Notification