Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-180 of human CD7 (NP_006128.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.
The antibody against CD7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-180 of human CD7 (NP_006128.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.
| Cat.No | ADA-09300A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD7 |
| Target Synonyms | GP40; TP41; Tp40; LEU-9; CD7 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Rat spleen, U-937 | Application | ELISA, WB, FC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 26-180 of human CD7 (NP_006128.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP | Uniprot ID | P09564 |
Uniprot Id
P09564
Target Species
Human
Target Name
CD7
Target Full Name
T-cell antigen CD7
Target Function
Not yet known.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Research Area
Immunology
Target Synonyms
CD7; CD7 antigen (p41); CD7 antigen; CD7 molecule; CD7_HUMAN; GP40; LEU 9; LEU9; p41 protein; T cell antigen CD7; T cell leukemia antigen ; T cell surface antigen Leu 9; T-cell antigen CD7; T-cell leukemia antigen; T-cell surface antigen Leu-9; Tp 40; Tp40; TP41
Target Background
This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
