Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDC25C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human CDC25C (NP_001781.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDC25C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human CDC25C (NP_001781.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11340A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDC25C |
| Target Synonyms | CDC25; PPP1R60; CDC25C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse thymus, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human CDC25C (NP_001781.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST | Uniprot ID | P30307 |
Uniprot Id
P30307
Target Species
Human
Target Name
CDC25C
Target Full Name
M-phase inducer phosphatase 3
Target Function
Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity.
Target Subcellular Location
Nucleus.
Target Protein Families
MPI phosphatase family
Target Research Area
Cell Biology
Target Synonyms
CDC 25; Cdc 25C; CDC25; CDC25C; Cell division cycle 25 homolog C; Cell division cycle 25C; Cell division cycle 25C protein; Dual specificity phosphatase Cdc25C; M phase inducer phosphatase 3; M-phase inducer phosphatase 3; Mitosis inducer CDC25; MPIP3; MPIP3_HUMAN; Phosphotyrosine phosphatase; PPP1R60; protein phosphatase 1, regulatory subunit 60
Target Background
This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
