Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDCA3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CDCA3 (NP_001284531.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDCA3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CDCA3 (NP_001284531.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04604A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDCA3 |
| Target Synonyms | GRCC8; TOME1; TOME-1; CDCA3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CDCA3 (NP_001284531.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES | Uniprot ID | Q99618 |
Uniprot Id
Q99618
Target Species
Human
Target Name
CDCA3
Target Full Name
Cell division cycle-associated protein 3
Target Function
F-box-like protein which is required for entry into mitosis. Acts by participating in E3 ligase complexes that mediate the ubiquitination and degradation of WEE1 kinase at G2/M phase.
Target Subcellular Location
Cytoplasm, cytosol.
Target Synonyms
CDCA3; C8; GRCC8; TOME1Cell division cycle-associated protein 3; Gene-rich cluster protein C8; Trigger of mitotic entry protein 1; TOME-1
Target Background
Predicted to be involved in cell division and protein ubiquitination. Located in adherens junction.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
