-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDKN1B/p27KIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human CDKN1B/p27KIP1 (NP_004055.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CDKN1B/p27KIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human CDKN1B/p27KIP1 (NP_004055.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09110A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDKN1B/p27KIP1 |
| Target Synonyms | KIP1; MEN4; CDKN4; MEN1B; P27KIP1; CDKN1B/p27KIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, 293T, HepG2, MCF7, Mouse lung, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human CDKN1B/p27KIP1 (NP_004055.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT | Uniprot ID | P46527 |
Uniprot Id
P46527
Target Species
Human
Target Name
CDKN1B
Target Full Name
Cyclin-dependent kinase inhibitor 1B
Target Function
Important regulator of cell cycle progression. Inhibits the kinase activity of CDK2 bound to cyclin A, but has little inhibitory activity on CDK2 bound to SPDYA. Involved in G1 arrest. Potent inhibitor of cyclin E- and cyclin A-CDK2 complexes. Forms a complex with cyclin type D-CDK4 complexes and is involved in the assembly, stability, and modulation of CCND1-CDK4 complex activation. Acts either as an inhibitor or an activator of cyclin type D-CDK4 complexes depending on its phosphorylation state and/or stoichometry.
Target Involvement
Multiple endocrine neoplasia 4 (MEN4)
Target Subcellular Location
Nucleus. Cytoplasm. Endosome.
Target Protein Families
CDI family
Target Tissue Specificity
Expressed in all tissues tested. Highest levels in skeletal muscle, lowest in liver and kidney.
Target Synonyms
AA408329; AI843786; Cdki1b; CDKN 1B; CDKN 4; CDKN1B; CDKN4; CDN1B_HUMAN; Cyclin Dependent Kinase Inhibitor 1B; Cyclin dependent kinase inhibitor p27; Cyclin-dependent kinase inhibitor 1B (p27; Kip1); Cyclin-dependent kinase inhibitor 1B; Cyclin-dependent kinase inhibitor p27; Cyclin-dependent kinase inhibitor p27 Kip1; KIP 1; KIP1; MEN1B; MEN4; OTTHUMP00000195098; OTTHUMP00000195099; p27; p27 Kip1; P27-like cyclin-dependent kinase inhibitor; p27Kip1
Target Background
This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4).
Notification