Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 136-265 of human CDX1 (NP_001795.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 136-265 of human CDX1 (NP_001795.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09655A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDX1 |
| Target Synonyms | CDX1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 136-265 of human CDX1 (NP_001795.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP | Uniprot ID | P47902 |
Uniprot Id
P47902
Target Species
Human
Target Name
CDX1
Target Full Name
Homeobox protein CDX-1
Target Function
Plays a role in transcriptional regulation. Involved in activated KRAS-mediated transcriptional activation of PRKD1 in colorectal cancer (CRC) cells. Binds to the PRKD1 promoter in colorectal cancer (CRC) cells. Could play a role in the terminal differentiation of the intestine. Binds preferentially to methylated DNA.
Target Subcellular Location
Nucleus.
Target Protein Families
Caudal homeobox family
Target Tissue Specificity
Intestinal epithelium.
Target Synonyms
Caudal type homeo box transcription factor 1 ; Caudal type homeobox 1; Caudal type homeobox protein ; Caudal type homeobox protein CDX1; Caudal type homeobox transcription factor 1; Caudal-type homeobox protein 1; CDX1; CDX1_HUMAN; Homeobox protein CDX 1; Homeobox protein CDX-1; MGC116915; OTTHUMP00000160524
Target Background
This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
