-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CENPB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human CENPB (NP_001801.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CENPB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human CENPB (NP_001801.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06497A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CENPB |
| Target Synonyms | CENPB | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human CENPB (NP_001801.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS | Uniprot ID | P07199 |
Uniprot Id
P07199
Target Species
Human
Target Name
CENPB
Target Full Name
Major centromere autoantigen B
Target Function
Interacts with centromeric heterochromatin in chromosomes and binds to a specific 17 bp subset of alphoid satellite DNA, called the CENP-B box. May organize arrays of centromere satellite DNA into a higher-order structure which then directs centromere formation and kinetochore assembly in mammalian chromosomes (Probable).
Target Subcellular Location
Nucleus. Chromosome, centromere.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CENP B; CENP-B; CENPB; CENPB_HUMAN; centromere autoantigen B; Centromere protein B; Centromere protein B; 80kDa; Major centromere autoantigen B
Target Background
This gene product is a highly conserved protein that facilitates centromere formation. It is a DNA-binding protein that is derived from transposases of the pogo DNA transposon family. It contains a helix-loop-helix DNA binding motif at the N-terminus, and a dimerization domain at the C-terminus. The DNA binding domain recognizes and binds a 17-bp sequence (CENP-B box) in the centromeric alpha satellite DNA. This protein is proposed to play an important role in the assembly of specific centromere structures in interphase nuclei and on mitotic chromosomes. It is also considered a major centromere autoantigen recognized by sera from patients with anti-centromere antibodies.
Notification