Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CERS5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CERS5 (NP_001268660.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CERS5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CERS5 (NP_001268660.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02097A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CERS5 |
| Target Synonyms | Trh4; LASS5; CERS5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CERS5 (NP_001268660.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMKPRPKRFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYG | Uniprot ID | Q8N5B7 |
Uniprot Id
Q8N5B7
Target Species
Human
Target Name
CERS5
Target Full Name
Ceramide synthase 5
Target Function
Ceramide synthase that catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward palmitoyl-CoA (hexadecanoyl-CoA; C16:0-CoA)(PubMed:16951403, PubMed:18541923, PubMed:22144673, PubMed:22661289, PubMed:23530041, PubMed:26887952, PubMed:29632068, PubMed:31916624). Can use other acyl donors, but with less efficiency. N-acylates sphinganine and sphingosine bases to form dihydroceramides and ceramides in de novo synthesis and salvage pathways, respectively. Plays a role in de novo ceramide synthesis and surfactant homeostasis in pulmonary epithelia.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Synonyms
CERS5; LASS5; Ceramide synthase 5; CerS5; LAG1 longevity assurance homolog 5; Sphingoid base N-palmitoyltransferase CERS5; Sphingosine N-acyltransferase CERS5
Target Background
This gene encodes a protein that belongs to the TLC (TRAM, LAG1 and CLN8 homology domains) family of proteins. The encoded protein functions in the synthesis of ceramide, a lipid molecule that is involved in a several cellular signaling pathways. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
