Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CFHR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 151-330 of human CFHR1 (NP_002104.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CFHR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 151-330 of human CFHR1 (NP_002104.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04280A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CFHR1 |
| Target Synonyms | H36; CFHL; FHR1; HFL1; HFL2; CFHL1; FHL-1; FHR-1; H36-1; H36-2; CFHL1P; CFHR1P; CFHR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, LO2, Mouse liver, Mouse lung, NCI-H460, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 151-330 of human CFHR1 (NP_002104.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PTVQNAHILSRQMSKYPSGERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR | Uniprot ID | Q03591 |
Uniprot Id
Q03591
Target Species
Human
Target Name
CFHR1
Target Full Name
Complement factor H-related protein 1
Target Function
Involved in complement regulation. The dimerized forms have avidity for tissue-bound complement fragments and efficiently compete with the physiological complement inhibitor CFH. Can associate with lipoproteins and may play a role in lipid metabolism.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Expressed by the liver and secreted in plasma.
Target Research Area
Cardiovascular
Target Synonyms
(FHR-1)(H factor-like protein 1)(H-factor-like 1)(H36)
Target Background
This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
