Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHERP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 650-750 of human CHERP (NP_006378.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHERP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 650-750 of human CHERP (NP_006378.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00944A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHERP |
| Target Synonyms | SRA1; DAN16; SCAF6; CHERP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, HepG2, Jurkat, Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 650-750 of human CHERP (NP_006378.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSS | Uniprot ID | Q8IWX8 |
Uniprot Id
Q8IWX8
Target Species
Human
Target Name
CHERP
Target Full Name
Calcium homeostasis endoplasmic reticulum protein
Target Function
Involved in calcium homeostasis, growth and proliferation.
Target Subcellular Location
Cytoplasm. Cytoplasm, perinuclear region. Endoplasmic reticulum.
Target Tissue Specificity
Expressed in brain, placenta, lung, liver, kidney, pancreas, cardiac and skeletal muscle, and in cultured HEL and Dami cells.
Target Synonyms
CHERP; DAN26; SCAF6Calcium homeostasis endoplasmic reticulum protein; ERPROT 213-21; SR-related CTD-associated factor 6
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
