-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Chk1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Chk1 (NP_001107593.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Chk1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Chk1 (NP_001107593.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14740A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Chk1 |
| Target Synonyms | CHK1; Chk1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Chk1 (NP_001107593.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP | Uniprot ID | O14757 |
Uniprot Id
O14757
Target Species
Human
Target Name
CHEK1
Target Full Name
Serine/threonine-protein kinase Chk1
Target Function
Serine/threonine-protein kinase which is required for checkpoint-mediated cell cycle arrest and activation of DNA repair in response to the presence of DNA damage or unreplicated DNA. May also negatively regulate cell cycle progression during unperturbed cell cycles. This regulation is achieved by a number of mechanisms that together help to preserve the integrity of the genome. Recognizes the substrate consensus sequence Endogenous repressor of isoform 1, interacts with, and antagonizes CHK1 to promote the S to G2/M phase transition.
Target Subcellular Location
Nucleus. Chromosome. Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, NIM1 subfamily
Target Tissue Specificity
Expressed ubiquitously with the most abundant expression in thymus, testis, small intestine and colon.
Target Synonyms
C85740; Cell cycle checkpoint kinase; Checkpoint ; S. pombe; homolog of; 1; Checkpoint kinase 1; Checkpoint kinase 1 homolog (S. pombe); CHEK 1; Chek1; Chk 1; Chk1; CHK1 checkpoint homolog (S. pombe); CHK1_HUMAN; EC 2.7.11.1; rad27; Serine/threonine protein kinase Chk1; Serine/threonine-protein kinase CHK1; STT3; subunit of the oligosaccharyltransferase complex; homolog A (S. cerevisiae)
Target Background
The protein encoded by this gene belongs to the Ser/Thr protein kinase family. It is required for checkpoint mediated cell cycle arrest in response to DNA damage or the presence of unreplicated DNA. This protein acts to integrate signals from ATM and ATR, two cell cycle proteins involved in DNA damage responses, that also associate with chromatin in meiotic prophase I. Phosphorylation of CDC25A protein phosphatase by this protein is required for cells to delay cell cycle progression in response to double-strand DNA breaks. Several alternatively spliced transcript variants have been found for this gene.
Notification