-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cip4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cip4 (Q15642) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cip4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cip4 (Q15642) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13495A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cip4 |
| Target Synonyms | STP; CIP4; HSTP; STOT; TRIP-10; Cip4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Hep G2, Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cip4 (Q15642). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCL | Uniprot ID | Q15642 |
Uniprot Id
Q15642
Target Species
Human
Target Name
TRIP10
Target Full Name
Cdc42-interacting protein 4
Target Function
Required for translocation of GLUT4 to the plasma membrane in response to insulin signaling. Required to coordinate membrane tubulation with reorganization of the actin cytoskeleton during endocytosis. Binds to lipids such as phosphatidylinositol 4,5-bisphosphate and phosphatidylserine and promotes membrane invagination and the formation of tubules. Also promotes CDC42-induced actin polymerization by recruiting WASL/N-WASP which in turn activates the Arp2/3 complex. Actin polymerization may promote the fission of membrane tubules to form endocytic vesicles. Required for the formation of podosomes, actin-rich adhesion structures specific to monocyte-derived cells. May be required for the lysosomal retention of FASLG/FASL.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. Lysosome. Golgi apparatus. Cell membrane. Cell projection, phagocytic cup.; [Isoform 5]: Cytoplasm, perinuclear region.
Target Protein Families
FNBP1 family
Target Tissue Specificity
Expressed in brain, colon, heart, kidney, liver, lung, megakaryocyte, ovary, pancreas, peripheral blood lymphocytes, placenta, prostate, skeletal muscle, small intestine, spleen, testis, thymus and trachea.
Target Synonyms
Cdc42 interacting protein 4; Cdc42 interaction protein 4 long isoform; Cdc42-interacting protein 4; CG11341; CG15015 PA; Cip 4; CIP4; CIP4_HUMAN; DCIP4; hSTP; Protein Felic; Salt tolerant protein; Salt tolerator; STOT; STP; Thyroid hormone receptor interactor 10; Thyroid receptor interacting protein 10; Thyroid receptor-interacting protein 10; TR-interacting protein 10; TRIP 10; TRIP-10; trip10; Truncated Cdc42 interaction protein 4
Target Background
Enables identical protein binding activity. Predicted to be involved in actin cytoskeleton organization; endocytosis; and signal transduction. Located in nucleoplasm. Biomarker of Huntington's disease.
Notification