Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CISD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-108 of human CISD1 (NP_060934.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CISD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-108 of human CISD1 (NP_060934.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09039A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CISD1 |
| Target Synonyms | ZCD1; MDS029; C10orf70; mitoNEET; CISD1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-108 of human CISD1 (NP_060934.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET | Uniprot ID | Q9NZ45 |
Uniprot Id
Q9NZ45
Target Species
Human
Target Name
CISD1
Target Full Name
CDGSH iron-sulfur domain-containing protein 1
Target Function
Plays a key role in regulating maximal capacity for electron transport and oxidative phosphorylation. May be involved in Fe-S cluster shuttling and/or in redox reactions.
Target Subcellular Location
Mitochondrion outer membrane; Single-pass type III membrane protein.
Target Protein Families
CISD protein family
Target Tissue Specificity
Expression is reduced in cells derived from cystic fibrosis patients.
Target Synonyms
AU043990; AW743335; C10orf70; CDGSH iron sulfur domain 1; CDGSH iron-sulfur domain-containing protein 1; CISD 1; CISD1; CISD1_HUMAN; D10Ertd214e; MDS029; MGC14684; MitoNEET; RGD1309529; ZCD1; Zinc finger CDGSH type domain 1
Target Background
This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
