-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CKMT1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human CKMT1B (NP_066270.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against CKMT1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human CKMT1B (NP_066270.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-04202A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CKMT1B |
| Target Synonyms | CKMT; CKMT1; UMTCK; CKMT1B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human CKMT1B (NP_066270.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT | Uniprot ID | P12532 |
Uniprot Id
P12532
Target Species
Human
Target Name
CKMT1A
Target Full Name
Creatine kinase U-type, mitochondrial
Target Function
Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.
Target Protein Families
ATP:guanido phosphotransferase family
Target Research Area
Signal Transduction
Target Synonyms
Acidic-type mitochondrial creatine kinase; CKMT; CKMT1; CKMT1B; Creatine kinase mitochondrial 1 (ubiquitous); Creatine kinase mitochondrial 1B; Creatine kinase U type mitochondrial; Creatine kinase U-type; KCRU_HUMAN; Mia-CK; mitochondrial; U-MtCK; Ubiquitous mitochondrial creatine kinase; UMTCK
Target Background
Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins.
Notification