-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Clathrin heavy chain was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1550-1650 of human Clathrin heavy chain (NP_004850.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Clathrin heavy chain was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1550-1650 of human Clathrin heavy chain (NP_004850.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01889A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Clathrin heavy chain |
| Target Synonyms | Hc; CHC; CHC17; MRD56; CLH-17; CLTCL2; Clathrin heavy chain | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, BT-474, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1550-1650 of human Clathrin heavy chain (NP_004850.1) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVP | Uniprot ID | Q00610 |
Uniprot Id
Q00610
Target Species
Human
Target Name
CLTC
Target Full Name
Clathrin heavy chain 1
Target Function
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge. The TACC3/ch-TOG/clathrin complex is required for the maintenance of kinetochore fiber tension. Plays a role in early autophagosome formation.
Target Subcellular Location
Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Membrane, coated pit; Peripheral membrane protein; Cytoplasmic side. Melanosome. Cytoplasm, cytoskeleton, spindle.
Target Protein Families
Clathrin heavy chain family
Target Synonyms
Hc; CHC; CHC17; MRD56; CLH-17; CLTCL2; Clathrin heavy chain
Target Background
Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.
Notification