-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLDN18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-261 of human CLDN18 (NP_057453.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLDN18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-261 of human CLDN18 (NP_057453.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01419A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLDN18 |
| Target Synonyms | SFTA5; SFTPJ; CLDN18 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, NUGC-4 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-261 of human CLDN18 (NP_057453.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV | Uniprot ID | P56856 |
Uniprot Id
P56856
Target Species
Human
Target Name
CLDN18
Target Full Name
Claudin-18
Target Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Target Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Claudin family
Target Tissue Specificity
Isoform A1: Expression is restricted to the lung. Isoform A2: Expression is restricted to the stomach mucosa where it is predominantly observed in the epithelial cells of the pit region and the base of the gastric glands including exocrine and endocrine c
Target Research Area
Signal Transduction
Target Synonyms
CLDN18; UNQ778/PRO1572; Claudin-18
Target Background
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification