-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLSTN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 730-850 of human CLSTN3 (NP_055533.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLSTN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 730-850 of human CLSTN3 (NP_055533.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10058A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLSTN3 |
| Target Synonyms | CSTN3; CDHR14; alcbeta; CLSTN3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 730-850 of human CLSTN3 (NP_055533.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHGAALYTRKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQPPPEMAGHSLASSHRNSMIPSAATL | Uniprot ID | Q9BQT9 |
Uniprot Id
Q9BQT9
Target Species
Human
Target Name
CLSTN3
Target Full Name
Calsyntenin-3
Target Function
May modulate calcium-mediated postsynaptic signals. Complex formation with APBA2 and APP, stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane. Golgi apparatus membrane. Cell junction, synapse, postsynapse. Cell projection, dendrite.
Target Tissue Specificity
According to PubMed:12498782, expressed predominantly in the brain and in kidney. Low levels in heart, skeletal muscle, liver, placenta, pancreas and lung. According to PubMed:12972431, predominant expression in brain, and only marginal in kidney. In brai
Target Synonyms
CLSTN3; CS3; KIAA0726Calsyntenin-3; Alcadein-beta; Alc-beta
Target Background
Predicted to enable calcium ion binding activity. Predicted to be involved in positive regulation of synapse assembly and positive regulation of synaptic transmission. Predicted to act upstream of or within several processes, including chemical synaptic transmission; positive regulation of protein localization to synapse; and synapse assembly. Predicted to be located in postsynaptic density. Predicted to be part of protein-containing complex. Predicted to be active in several cellular components, including GABA-ergic synapse; glutamatergic synapse; and postsynaptic membrane. Predicted to be integral component of postsynaptic density membrane.
Notification