-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CMPK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 69-228 of human CMPK1 (NP_057392.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against CMPK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 69-228 of human CMPK1 (NP_057392.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-02963A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CMPK1 |
| Target Synonyms | CK; CMK; UMK; CMPK; UMPK; UMP-CMPK; CMPK1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, HL-60, HT-29, Mouse brain | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 69-228 of human CMPK1 (NP_057392.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKEG | Uniprot ID | P30085 |
Uniprot Id
P30085
Target Species
Human
Target Name
CMPK1
Target Full Name
UMP-CMP kinase
Target Function
Catalyzes the phosphorylation of pyrimidine nucleoside monophosphates at the expense of ATP. Plays an important role in de novo pyrimidine nucleotide biosynthesis. Has preference for UMP and CMP as phosphate acceptors. Also displays broad nucleoside diphosphate kinase activity.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Adenylate kinase family, UMP-CMP kinase subfamily
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
CMK; CMPK 1; CMPK; cmpk1; Cytidine monophosphate (UMP CMP) kinase 1 cytosolic; Cytidine monophosphate kinase; Cytidine monophosphate UMP CMP kinase 1 cytosolic; Cytidylate kinase; dCMP kinase; Deoxycytidylate kinase; EC 2.7.4.14; KCY; KCY_HUMAN; Monophosphatase kinase; OTTHUMP00000009565; RP11 511I2.1; UCK; UMK; UMP CMP; UMP CMP kinase; UMP-CMP kinase; UMP/CMP kinase; UMP/CMPK; UMPK; Uridine monophosphate kinase; Uridine monophosphate/cytidine monophosphate kinase
Target Background
This gene encodes one of the enzymes required for cellular nucleic acid biosynthesis. This enzyme catalyzes the transfer of a phosphate group from ATP to CMP, UMP, or dCMP, to form the corresponding diphosphate nucleotide. Alternate splicing results in both coding and non-coding transcript variants.
Notification