Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CNPase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 322-421 of human CNPase (P09543) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CNPase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 322-421 of human CNPase (P09543) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16542A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CNPase |
| Target Synonyms | CNP1; HLD20; CNPase | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 322-421 of human CNPase (P09543). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NLPRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII | Uniprot ID | P09543 |
Uniprot Id
P09543
Target Species
Human
Target Name
CNP
Target Full Name
2',3'-cyclic-nucleotide 3'-phosphodiesterase
Target Function
May participate in RNA metabolism in the myelinating cell, CNP is the third most abundant protein in central nervous system myelin.
Target Subcellular Location
Membrane; Lipid-anchor. Melanosome. Note=Firmly bound to membrane structures of brain white matter. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Target Protein Families
2H phosphoesterase superfamily, CNPase family
Target Synonyms
CNP1; HLD20; CNPase
Target Background
Predicted to enable 2', 3'-cyclic-nucleotide 3'-phosphodiesterase activity. Involved in substantia nigra development. Located in several cellular components, including extracellular space; microtubule; and plasma membrane. Implicated in hypomyelinating leukodystrophy 20; multiple sclerosis; and schizophrenia. Biomarker of alcoholic liver cirrhosis; multiple sclerosis; and restless legs syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
