Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CNR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CNR2 (NP_001832.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CNR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CNR2 (NP_001832.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09962A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CNR2 |
| Target Synonyms | CB2; CX5; CB-2; CNR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, THP-1 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CNR2 (NP_001832.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGV | Uniprot ID | P34972 |
Uniprot Id
P34972
Target Species
Human
Target Name
CNR2
Target Full Name
Cannabinoid receptor 2
Target Function
Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Perikaryon.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Preferentially expressed in cells of the immune system with higher expression in B-cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spl
Target Research Area
Neuroscience
Target Synonyms
CNR2; CB2A; CB2B; Cannabinoid receptor 2; CB-2; CB2; hCB2; CX5
Target Background
The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
